SCOPe 2.03: Domain d3auvc2: 3auv C:135-252

Lineage for d3auvc2 (3auv C:135-252)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3auvc2: 3auv C:135-252 [208383]
   automated match to d1dzba1

Details for d3auvc2

PDB Entry: 3auv, 2.4 Å

PDB Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface

PDB Compounds: (C:) sc-dsFv derived from the G6-Fab

SCOPe Domain Sequences for d3auvc2:

Sequence; same for both SEQRES and ATOM records:

>d3auvc2 b.1.1.0 (C:135-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv

Timeline for d3auvc2:

• d3auvc2 is new in SCOPe 2.03-stable
  
• d3auvc2 appears in SCOPe 2.04
  
• d3auvc2 appears in the current release, SCOPe 2.08