Lineage for d3auvb2 (3auv B:135-252)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519702Domain d3auvb2: 3auv B:135-252 [208381]
    automated match to d1dzba1

Details for d3auvb2

PDB Entry: 3auv (more details), 2.4 Å

PDB Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface
PDB Compounds: (B:) sc-dsFv derived from the G6-Fab

SCOPe Domain Sequences for d3auvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auvb2 b.1.1.0 (B:135-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtv

SCOPe Domain Coordinates for d3auvb2:

Click to download the PDB-style file with coordinates for d3auvb2.
(The format of our PDB-style files is described here.)

Timeline for d3auvb2: