Lineage for d1ld9e1 (1ld9 E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103286Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 103516Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries)
  8. 103520Domain d1ld9e1: 1ld9 E: [20838]
    Other proteins in same PDB: d1ld9a2, d1ld9d2

Details for d1ld9e1

PDB Entry: 1ld9 (more details), 2.4 Å

PDB Description: the three-dimensional structure of an h-2ld peptide complex explains the unique interaction of ld with beta2m and peptide

SCOP Domain Sequences for d1ld9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ld9e1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1ld9e1:

Click to download the PDB-style file with coordinates for d1ld9e1.
(The format of our PDB-style files is described here.)

Timeline for d1ld9e1: