Lineage for d3auva2 (3auv A:135-253)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296323Domain d3auva2: 3auv A:135-253 [208379]
    automated match to d1dzba1

Details for d3auva2

PDB Entry: 3auv (more details), 2.4 Å

PDB Description: Predicting Amino Acid Preferences in the Complementarity Determining Regions of an Antibody-Antigen Recognition Interface
PDB Compounds: (A:) sc-dsFv derived from the G6-Fab

SCOPe Domain Sequences for d3auva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auva2 b.1.1.0 (A:135-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkclewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvs

SCOPe Domain Coordinates for d3auva2:

Click to download the PDB-style file with coordinates for d3auva2.
(The format of our PDB-style files is described here.)

Timeline for d3auva2: