Lineage for d3auba_ (3aub A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637463Species Cow (Bos taurus) [TaxId:9913] [186767] (20 PDB entries)
  8. 2637464Domain d3auba_: 3aub A: [208370]
    automated match to d3gymi_

Details for d3auba_

PDB Entry: 3aub (more details), 1 Å

PDB Description: A simplified BPTI variant stabilized by the A14G and A38V substitutions
PDB Compounds: (A:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3auba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auba_ g.8.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaacaaa

SCOPe Domain Coordinates for d3auba_:

Click to download the PDB-style file with coordinates for d3auba_.
(The format of our PDB-style files is described here.)

Timeline for d3auba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3aubb_