Lineage for d3atua1 (3atu A:4-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2883385Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2883861Protein automated matches [226905] (13 species)
    not a true protein
  7. 2883942Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries)
  8. 2883947Domain d3atua1: 3atu A:4-188 [208366]
    automated match to d2qw9a1
    complexed with adp, mg, na, pg0, po4

Details for d3atua1

PDB Entry: 3atu (more details), 1.65 Å

PDB Description: Crystal structure of human Hsp70 NBD in the ADP- and Mg ion-bound state
PDB Compounds: (A:) Heat shock 70 kDa protein 1A/1B

SCOPe Domain Sequences for d3atua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atua1 c.55.1.1 (A:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

SCOPe Domain Coordinates for d3atua1:

Click to download the PDB-style file with coordinates for d3atua1.
(The format of our PDB-style files is described here.)

Timeline for d3atua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3atua2