Lineage for d3athc_ (3ath C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897868Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries)
  8. 2897872Domain d3athc_: 3ath C: [208363]
    automated match to d4gebb_
    complexed with akg, plp

Details for d3athc_

PDB Entry: 3ath (more details), 1.69 Å

PDB Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with four AKGs as substrates and allosteric effectors
PDB Compounds: (C:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3athc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3athc_ c.67.1.0 (C:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

SCOPe Domain Coordinates for d3athc_:

Click to download the PDB-style file with coordinates for d3athc_.
(The format of our PDB-style files is described here.)

Timeline for d3athc_: