Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries) |
Domain d1ld9b1: 1ld9 B: [20836] Other proteins in same PDB: d1ld9a2, d1ld9d2 |
PDB Entry: 1ld9 (more details), 2.4 Å
SCOP Domain Sequences for d1ld9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ld9b1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1ld9b1: