Lineage for d3asva_ (3asv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846812Species Escherichia coli [TaxId:562] [187725] (8 PDB entries)
  8. 2846831Domain d3asva_: 3asv A: [208356]
    automated match to d2nwqd_
    complexed with nap, po4

Details for d3asva_

PDB Entry: 3asv (more details), 2.7 Å

PDB Description: The Closed form of serine dehydrogenase complexed with NADP+
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3asva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asva_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy
aglnvhrq

SCOPe Domain Coordinates for d3asva_:

Click to download the PDB-style file with coordinates for d3asva_.
(The format of our PDB-style files is described here.)

Timeline for d3asva_: