Lineage for d3asua_ (3asu A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580659Species Escherichia coli [TaxId:562] [187725] (4 PDB entries)
  8. 1580660Domain d3asua_: 3asu A: [208354]
    automated match to d2nwqd_

Details for d3asua_

PDB Entry: 3asu (more details), 1.9 Å

PDB Description: crystal structure of serine dehydrogenase from escherichia coli
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3asua_:

Sequence, based on SEQRES records: (download)

>d3asua_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
ggtefsnvrfkgddgkaektyqntvaltpedvseavwwvstlpahvnintlemmpvtqsy

Sequence, based on observed residues (ATOM records): (download)

>d3asua_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mivlvtgatagfgecitrrfiqqghkviatgrrqerlqelkdelgdnlyiaqldvrnraa
ieemlaslpaewcnidilvnnaglalgmepahkasvedwetmidtnnkglvymtravlpg
mvernhghiinigstagswpyaggnvygatkafvrqfslnlrtdlhgtavrvtdiepglv
ggvaltpedvseavwwvstlpahvnintlemmpvtqsy

SCOPe Domain Coordinates for d3asua_:

Click to download the PDB-style file with coordinates for d3asua_.
(The format of our PDB-style files is described here.)

Timeline for d3asua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3asub_