SCOPe 2.04: Domain d3arnc_: 3arn C:

Lineage for d3arnc_ (3arn C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226031] (4 PDB entries)

8. Domain d3arnc_: 3arn C: [208353]
   automated match to d4apza_
   complexed with mg, msj

Details for d3arnc_

PDB Entry: 3arn, 1.8 Å

PDB Description: human dutpase in complex with novel uracil derivative

PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3arnc_:

Sequence; same for both SEQRES and ATOM records:

>d3arnc_ b.85.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqal

Timeline for d3arnc_:

• d3arnc_ first appeared in SCOPe 2.03
  
• d3arnc_ appears in SCOPe 2.05
  
• d3arnc_ appears in the current release, SCOPe 2.08