Lineage for d3arla_ (3arl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302854Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302855Protein automated matches [190590] (26 species)
    not a true protein
  7. 2303042Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)
  8. 2303045Domain d3arla_: 3arl A: [208350]
    automated match to d1x3ka_
    complexed with cl, hem

Details for d3arla_

PDB Entry: 3arl (more details), 1.81 Å

PDB Description: Cl- binding hemoglobin component V form Propsilocerus akamusi under 500 mM NaCl at pH 5.5
PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d3arla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arla_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

SCOPe Domain Coordinates for d3arla_:

Click to download the PDB-style file with coordinates for d3arla_.
(The format of our PDB-style files is described here.)

Timeline for d3arla_: