![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries) |
![]() | Domain d3arla_: 3arl A: [208350] automated match to d1x3ka_ complexed with cl, hem |
PDB Entry: 3arl (more details), 1.81 Å
SCOPe Domain Sequences for d3arla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arla_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]} afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh ldsthgaawnkmmdnffyvfyecldgrcsqfs
Timeline for d3arla_: