Lineage for d3arja_ (3arj A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1256210Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1256211Protein automated matches [190590] (11 species)
    not a true protein
  7. 1256282Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)
  8. 1256286Domain d3arja_: 3arj A: [208348]
    automated match to d1x3ka_
    complexed with cl, hem

Details for d3arja_

PDB Entry: 3arj (more details), 1.81 Å

PDB Description: cl- binding hemoglobin component v form propsilocerus akamusi under 500 mm nacl at ph 4.6
PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d3arja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arja_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

SCOPe Domain Coordinates for d3arja_:

Click to download the PDB-style file with coordinates for d3arja_.
(The format of our PDB-style files is described here.)

Timeline for d3arja_: