Lineage for d3arac_ (3ara C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818270Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2818271Protein automated matches [191182] (20 species)
    not a true protein
  7. 2818403Species Human (Homo sapiens) [TaxId:9606] [226031] (5 PDB entries)
  8. 2818412Domain d3arac_: 3ara C: [208347]
    automated match to d4apza_
    complexed with mg, mkh

Details for d3arac_

PDB Entry: 3ara (more details), 1.7 Å

PDB Description: discovery of novel uracil derivatives as potent human dutpase inhibitors
PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3arac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3arac_ b.85.4.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlrfarlsehataptrgsaraagydlysaydytippmekavvktdiqialpsgcygrva
prsglaakhfidvgagvidedyrgnvgvvlfnfgkekfevkkgdriaqlicerifypeie
evqal

SCOPe Domain Coordinates for d3arac_:

Click to download the PDB-style file with coordinates for d3arac_.
(The format of our PDB-style files is described here.)

Timeline for d3arac_: