Lineage for d3ar9a3 (3ar9 A:344-360,A:600-750)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167189Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (3 proteins)
    interrupted by a large insertion, domain N
  6. 2167190Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 2167191Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (43 PDB entries)
    Uniprot P04191
  8. 2167207Domain d3ar9a3: 3ar9 A:344-360,A:600-750 [208343]
    Other proteins in same PDB: d3ar9a1, d3ar9a2, d3ar9a4
    automated match to d1wpga2
    complexed with bef, mg, na, tg1, tm1

Details for d3ar9a3

PDB Entry: 3ar9 (more details), 2.6 Å

PDB Description: Calcium pump crystal structure with bound BeF3, TNP-AMP and TG in the absence of calcium
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3ar9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ar9a3 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOPe Domain Coordinates for d3ar9a3:

Click to download the PDB-style file with coordinates for d3ar9a3.
(The format of our PDB-style files is described here.)

Timeline for d3ar9a3: