Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (37 PDB entries) Uniprot P04191 |
Domain d3ar9a2: 3ar9 A:125-239 [208342] Other proteins in same PDB: d3ar9a1, d3ar9a3, d3ar9a4 automated match to d1wpga1 complexed with bef, mg, na, tg1, tm1 |
PDB Entry: 3ar9 (more details), 2.6 Å
SCOPe Domain Sequences for d3ar9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ar9a2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d3ar9a2: