Lineage for d3ar9a1 (3ar9 A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458250Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 1458251Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 1458252Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 1458253Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 1458254Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (37 PDB entries)
    Uniprot P04191
  8. 1458273Domain d3ar9a1: 3ar9 A:1-124,A:240-343,A:751-994 [208341]
    Other proteins in same PDB: d3ar9a2, d3ar9a3, d3ar9a4
    automated match to d1wpga4
    complexed with bef, mg, na, tg1, tm1

Details for d3ar9a1

PDB Entry: 3ar9 (more details), 2.6 Å

PDB Description: Calcium pump crystal structure with bound BeF3, TNP-AMP and TG in the absence of calcium
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3ar9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ar9a1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d3ar9a1:

Click to download the PDB-style file with coordinates for d3ar9a1.
(The format of our PDB-style files is described here.)

Timeline for d3ar9a1: