Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [48961] (1 PDB entry) |
Domain d1mhce1: 1mhc E: [20834] Other proteins in same PDB: d1mhca2, d1mhcd2 |
PDB Entry: 1mhc (more details), 2.1 Å
SCOP Domain Sequences for d1mhce1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhce1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2M3} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1mhce1: