Lineage for d3ar6a2 (3ar6 A:125-239)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082621Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2082622Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2082623Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2082624Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries)
    Uniprot P04191
  8. 2082650Domain d3ar6a2: 3ar6 A:125-239 [208330]
    Other proteins in same PDB: d3ar6a1, d3ar6a3, d3ar6a4
    automated match to d1wpga1
    complexed with 12d, mg, na, pty, tg1

Details for d3ar6a2

PDB Entry: 3ar6 (more details), 2.2 Å

PDB Description: Calcium pump crystal structure with bound TNP-ADP and TG in the absence of calcium
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3ar6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ar6a2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d3ar6a2:

Click to download the PDB-style file with coordinates for d3ar6a2.
(The format of our PDB-style files is described here.)

Timeline for d3ar6a2: