Lineage for d1mhcd1 (1mhc D:182-276)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784672Domain d1mhcd1: 1mhc D:182-276 [20833]
    Other proteins in same PDB: d1mhca2, d1mhcb_, d1mhcd2, d1mhce_
    complexed with nag; mutant

Details for d1mhcd1

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution
PDB Compounds: (D:) MHC class I antigen h2-m3

SCOP Domain Sequences for d1mhcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhcd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

SCOP Domain Coordinates for d1mhcd1:

Click to download the PDB-style file with coordinates for d1mhcd1.
(The format of our PDB-style files is described here.)

Timeline for d1mhcd1: