SCOP 1.73: Domain d1mhcd1: 1mhc D:182-276

Lineage for d1mhcd1 (1mhc D:182-276)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)

8. Domain d1mhcd1: 1mhc D:182-276 [20833]
   Other proteins in same PDB: d1mhca2, d1mhcb_, d1mhcd2, d1mhce_
   complexed with nag; mutant

Details for d1mhcd1

PDB Entry: 1mhc, 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

PDB Compounds: (D:) MHC class I antigen h2-m3

SCOP Domain Sequences for d1mhcd1:

Sequence; same for both SEQRES and ATOM records:

>d1mhcd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

Timeline for d1mhcd1:

• d1mhcd1 first appeared (with stable ids) in SCOP 1.55
  
• d1mhcd1 appears in SCOP 1.71
  
• d1mhcd1 appears in SCOP 1.75
  
• d1mhcd1 appears in the current release, SCOPe 2.08