Lineage for d1mhcd1 (1mhc D:182-276)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53139Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [48961] (1 PDB entry)
  8. 53142Domain d1mhcd1: 1mhc D:182-276 [20833]
    Other proteins in same PDB: d1mhca2, d1mhcd2

Details for d1mhcd1

PDB Entry: 1mhc (more details), 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1mhcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhcd1 b.1.1.2 (D:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2M3}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

SCOP Domain Coordinates for d1mhcd1:

Click to download the PDB-style file with coordinates for d1mhcd1.
(The format of our PDB-style files is described here.)

Timeline for d1mhcd1: