SCOP 1.55: Domain d1mhcd1: 1mhc D:182-276

Lineage for d1mhcd1 (1mhc D:182-276)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2M3 [TaxId:10090] [48961] (1 PDB entry)

8. Domain d1mhcd1: 1mhc D:182-276 [20833]
   Other proteins in same PDB: d1mhca2, d1mhcd2

Details for d1mhcd1

PDB Entry: 1mhc, 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1mhcd1:

Sequence; same for both SEQRES and ATOM records:

>d1mhcd1 b.1.1.2 (D:182-276) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2M3}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

Timeline for d1mhcd1:

• d1mhcd1 appears in SCOP 1.57
  
• d1mhcd1 appears in the current release, SCOPe 2.08