Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries) Uniprot P01901 22-299 |
Domain d1mhcd1: 1mhc D:182-276 [20833] Other proteins in same PDB: d1mhca2, d1mhcb_, d1mhcd2, d1mhce_ complexed with nag |
PDB Entry: 1mhc (more details), 2.1 Å
SCOPe Domain Sequences for d1mhcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhcd1 b.1.1.2 (D:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf qkwaavvvpsgeeqrytcyvhheglteplalkwrs
Timeline for d1mhcd1:
View in 3D Domains from other chains: (mouse over for more information) d1mhca1, d1mhca2, d1mhcb_, d1mhce_ |