Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily) core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains |
Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) |
Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein) |
Protein Calcium ATPase, transmembrane domain M [81663] (1 species) the N-terminal 40 residues interact with /form a part of transduction domain A |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (40 PDB entries) Uniprot P04191 |
Domain d3ar6a1: 3ar6 A:1-124,A:240-343,A:751-994 [208329] Other proteins in same PDB: d3ar6a2, d3ar6a3, d3ar6a4 automated match to d1wpga4 complexed with 12d, mg, na, pty, tg1 |
PDB Entry: 3ar6 (more details), 2.2 Å
SCOPe Domain Sequences for d3ar6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ar6a1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg
Timeline for d3ar6a1: