Lineage for d3ar4a2 (3ar4 A:125-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817328Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2817329Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2817330Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2817331Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries)
    Uniprot P04191
  8. 2817332Domain d3ar4a2: 3ar4 A:125-239 [208322]
    Other proteins in same PDB: d3ar4a1, d3ar4a3, d3ar4a4
    automated match to d1wpga1
    complexed with atp, mg, na, pty, tg1

Details for d3ar4a2

PDB Entry: 3ar4 (more details), 2.15 Å

PDB Description: Calcium pump crystal structure with bound ATP and TG in the absence of Ca2+
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3ar4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ar4a2 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d3ar4a2:

Click to download the PDB-style file with coordinates for d3ar4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ar4a2: