Lineage for d3aq9a_ (3aq9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302854Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2302855Protein automated matches [190590] (26 species)
    not a true protein
  7. 2303031Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries)
  8. 2303032Domain d3aq9a_: 3aq9 A: [208310]
    automated match to d1idrb_
    complexed with hem; mutant

Details for d3aq9a_

PDB Entry: 3aq9 (more details), 1.74 Å

PDB Description: Crystal structure of truncated hemoglobin from Tetrahymena pyriformis, Q50E mutant, Fe(III) form
PDB Compounds: (A:) Group 1 truncated hemoglobin

SCOPe Domain Sequences for d3aq9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aq9a_ a.1.1.0 (A:) automated matches {Tetrahymena pyriformis [TaxId: 5908]}
qtiyeklggenamkaavplfykkvladervkhffkntdmdhqtkqetdfltmllggpnhy
kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk

SCOPe Domain Coordinates for d3aq9a_:

Click to download the PDB-style file with coordinates for d3aq9a_.
(The format of our PDB-style files is described here.)

Timeline for d3aq9a_: