Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries) |
Domain d3aq9a_: 3aq9 A: [208310] automated match to d1idrb_ complexed with hem; mutant |
PDB Entry: 3aq9 (more details), 1.74 Å
SCOPe Domain Sequences for d3aq9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aq9a_ a.1.1.0 (A:) automated matches {Tetrahymena pyriformis [TaxId: 5908]} qtiyeklggenamkaavplfykkvladervkhffkntdmdhqtkqetdfltmllggpnhy kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk
Timeline for d3aq9a_: