SCOP 1.67: Domain d1mhca1: 1mhc A:182-276

Lineage for d1mhca1 (1mhc A:182-276)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)

8. Domain d1mhca1: 1mhc A:182-276 [20831]
   Other proteins in same PDB: d1mhca2, d1mhcb_, d1mhcd2, d1mhce_

Details for d1mhca1

PDB Entry: 1mhc, 2.1 Å

PDB Description: model of mhc class i h2-m3 with nonapeptide from rat nd1 refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1mhca1:

Sequence; same for both SEQRES and ATOM records:

>d1mhca1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
adppkahvahhprpkgdvtlrcwalgfypaditltwqkdeedltqdmelvetrpsgdgtf
qkwaavvvpsgeeqrytcyvhheglteplalkwrs

Timeline for d1mhca1:

• d1mhca1 first appeared (with stable ids) in SCOP 1.55
  
• d1mhca1 appears in SCOP 1.65
  
• d1mhca1 appears in SCOP 1.69
  
• d1mhca1 appears in the current release, SCOPe 2.08