Lineage for d3aq5b_ (3aq5 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718642Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries)
  8. 1718646Domain d3aq5b_: 3aq5 B: [208303]
    automated match to d1s61b_
    complexed with hem, oxy

Details for d3aq5b_

PDB Entry: 3aq5 (more details), 1.78 Å

PDB Description: Crystal structure of truncated hemoglobin from Tetrahymena pyriformis, Fe(II)-O2 form
PDB Compounds: (B:) Group 1 truncated hemoglobin

SCOPe Domain Sequences for d3aq5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aq5b_ a.1.1.0 (B:) automated matches {Tetrahymena pyriformis [TaxId: 5908]}
qtiyeklggenamkaavplfykkvladervkhffkntdmdhqtkqqtdfltmllggpnhy
kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk

SCOPe Domain Coordinates for d3aq5b_:

Click to download the PDB-style file with coordinates for d3aq5b_.
(The format of our PDB-style files is described here.)

Timeline for d3aq5b_: