| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Tetrahymena pyriformis [TaxId:5908] [226112] (5 PDB entries) |
| Domain d3aq5b_: 3aq5 B: [208303] automated match to d1s61b_ complexed with hem, oxy |
PDB Entry: 3aq5 (more details), 1.78 Å
SCOPe Domain Sequences for d3aq5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aq5b_ a.1.1.0 (B:) automated matches {Tetrahymena pyriformis [TaxId: 5908]}
qtiyeklggenamkaavplfykkvladervkhffkntdmdhqtkqqtdfltmllggpnhy
kgknmteahkgmnlqnlhfdaiienlaatlkelgvtdavineaakviehtrkdmlgk
Timeline for d3aq5b_: