| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) ![]() distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation |
| Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins) automatically mapped to Pfam PF02219 |
| Protein automated matches [193645] (4 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [193648] (2 PDB entries) |
| Domain d3apyh_: 3apy H: [208301] automated match to d3aptb_ complexed with cl, fad |
PDB Entry: 3apy (more details), 2.8 Å
SCOPe Domain Sequences for d3apyh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3apyh_ c.1.23.1 (H:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrp
Timeline for d3apyh_: