Lineage for d1bz9b_ (1bz9 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514314Domain d1bz9b_: 1bz9 B: [20830]
    Other proteins in same PDB: d1bz9a1, d1bz9a2

Details for d1bz9b_

PDB Entry: 1bz9 (more details), 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
PDB Compounds: (B:) protein (class I histocompatibility antigen)

SCOPe Domain Sequences for d1bz9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz9b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1bz9b_:

Click to download the PDB-style file with coordinates for d1bz9b_.
(The format of our PDB-style files is described here.)

Timeline for d1bz9b_: