SCOP 1.61: Domain d1bz9b1: 1bz9 B:

Lineage for d1bz9b1 (1bz9 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (9 PDB entries)

8. Domain d1bz9b1: 1bz9 B: [20830]
   Other proteins in same PDB: d1bz9a2

Details for d1bz9b1

PDB Entry: 1bz9, 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027

SCOP Domain Sequences for d1bz9b1:

Sequence; same for both SEQRES and ATOM records:

>d1bz9b1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1bz9b1:

• d1bz9b1 first appeared (with stable ids) in SCOP 1.55
  
• d1bz9b1 appears in SCOP 1.59
  
• d1bz9b1 is called d1bz9b_ in SCOP 1.63
  
• d1bz9b1 appears in the current release, SCOPe 2.08, called d1bz9b2