Lineage for d1bz9b1 (1bz9 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries) 
Domain d1bz9b1: 1bz9 B: [20830]
Other proteins in same PDB: d1bz9a2
Details for d1bz9b1
PDB Entry: 1bz9 (more details), 2.8 Å
PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
SCOP Domain Sequences for d1bz9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bz9b1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1bz9b1:
Click to download the PDB-style file with coordinates for d1bz9b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bz9b1:
- d1bz9b1 appears in SCOP 1.57
- d1bz9b1 appears in the current release, SCOPe 2.08, called d1bz9b2
View in 3D
