Lineage for d1bz9b2 (1bz9 B:1-99)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746672Domain d1bz9b2: 1bz9 B:1-99 [20830]
    Other proteins in same PDB: d1bz9a1, d1bz9a2, d1bz9b3

Details for d1bz9b2

PDB Entry: 1bz9 (more details), 2.8 Å

PDB Description: crystal structure of murine class i mhc h2-db complexed with a synthetic peptide p1027
PDB Compounds: (B:) protein (class I histocompatibility antigen)

SCOPe Domain Sequences for d1bz9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bz9b2 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1bz9b2:

Click to download the PDB-style file with coordinates for d1bz9b2.
(The format of our PDB-style files is described here.)

Timeline for d1bz9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bz9b3