Lineage for d3apya_ (3apy A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840637Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2840638Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins)
    automatically mapped to Pfam PF02219
  6. 2840664Protein automated matches [193645] (4 species)
    not a true protein
  7. 2840683Species Thermus thermophilus HB8 [TaxId:300852] [193648] (2 PDB entries)
  8. 2840686Domain d3apya_: 3apy A: [208294]
    automated match to d3aptb_
    complexed with cl, fad

Details for d3apya_

PDB Entry: 3apy (more details), 2.8 Å

PDB Description: Properties and crystal structure of methylenetetrahydrofolate reductase from Thermus thermophilus HB8
PDB Compounds: (A:) Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d3apya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3apya_ c.1.23.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrp

SCOPe Domain Coordinates for d3apya_:

Click to download the PDB-style file with coordinates for d3apya_.
(The format of our PDB-style files is described here.)

Timeline for d3apya_: