Lineage for d3aowa_ (3aow A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132849Species Pyrococcus horikoshii OT3 [TaxId:70601] [225184] (6 PDB entries)
  8. 2132850Domain d3aowa_: 3aow A: [208291]
    automated match to d4gebb_
    complexed with akg, plp

Details for d3aowa_

PDB Entry: 3aow (more details), 1.56 Å

PDB Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with AKG
PDB Compounds: (A:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3aowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aowa_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

SCOPe Domain Coordinates for d3aowa_:

Click to download the PDB-style file with coordinates for d3aowa_.
(The format of our PDB-style files is described here.)

Timeline for d3aowa_: