SCOPe 2.03: Domain d3aova_: 3aov A:

Lineage for d3aova_ (3aov A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [225184] (5 PDB entries)

8. Domain d3aova_: 3aov A: [208289]
   automated match to d4gebb_
   complexed with plp

Details for d3aova_

PDB Entry: 3aov, 1.72 Å

PDB Description: Crystal structure of Pyrococcus horikoshii kynurenine aminotransferase in complex with PLP

PDB Compounds: (A:) Putative uncharacterized protein PH0207

SCOPe Domain Sequences for d3aova_:

Sequence; same for both SEQRES and ATOM records:

>d3aova_ c.67.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
smlgdverffskkalemrasevrellklvetsdiislagglpnpktfpkeiirdilveim
ekyadkalqygttkgftplretlmkwlgkrygisqdndimitsgsqqaldligrvflnpg
divvveaptylaalqafnfyepqyiqiplddegmkveileeklkelksqgkkvkvvytvp
tfqnpagvtmnedrrkyllelaseydfivveddpygelrysgnpekkikaldnegrviyl
gtfskilapgfrigwmvgdpgiirkmeiakqstdlctnvfgqvvawryvdggylekhipe
irkfykprrdamlealeefmpegvkwtkpeggmfiwvtlpdgidskkmleraikkgvayv
pgeafyahrdvkntmrlnftyvdedkimegikrlaetikeelka

Timeline for d3aova_:

• d3aova_ is new in SCOPe 2.03-stable
  
• d3aova_ appears in SCOPe 2.04
  
• d3aova_ appears in the current release, SCOPe 2.08