Lineage for d3anja_ (3anj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2004319Species Streptococcus agalactiae [TaxId:216495] [225979] (3 PDB entries)
  8. 2004320Domain d3anja_: 3anj A: [208285]
    automated match to d2fuza_

Details for d3anja_

PDB Entry: 3anj (more details), 1.95 Å

PDB Description: Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae
PDB Compounds: (A:) Putative uncharacterized protein gbs1889

SCOPe Domain Sequences for d3anja_:

Sequence, based on SEQRES records: (download)

>d3anja_ a.102.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 216495]}
mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt
psctaeyringdvkaleatikaadklmeryqekggfiqawgelgykehyrliidcllniq
llffayeqtgdekyrqvavnhfyasannvvrddssafhtfyfdpetgeplkgvtrqgysd
esswargqawgiygiplsyrkmkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgq
prdtsatatavcgihemlkylpevdpdketykyamhtmlrslieqysnneliagrplllh
gvyswhsgkgvdegniwgdyyylealirfykdwelyw

Sequence, based on observed residues (ATOM records): (download)

>d3anja_ a.102.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 216495]}
mkikpvkvesienpkrflnsrlltkieveeaiekalkqlyinidyfgeeyptpatfnniy
kvmdntewtngfwtgclwlayeynqdkklkniahknvlsflnrinnrialdhhdlgflyt
psctaeyringdvkaleatikaadklmerliidcllniqllffayeqtgdekyrqvavnh
fyasannvvrddssafhtfyfdpetgeplkgvtrqgysdesswargqawgiygiplsyrk
mkdyqqiilfkgmtnyflnrlpedkvsywdliftdgsgqprdtsatatavcgihemlkyl
pevdpdketykyamhtmlrslieqysnneliagrplllhgvyswhsgkgvdegniwgdyy
ylealirfykdwelyw

SCOPe Domain Coordinates for d3anja_:

Click to download the PDB-style file with coordinates for d3anja_.
(The format of our PDB-style files is described here.)

Timeline for d3anja_: