Lineage for d3amzb5 (3amz B:537-694)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944852Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2944914Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2944915Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2944921Domain d3amzb5: 3amz B:537-694 [208282]
    Other proteins in same PDB: d3amza1, d3amza2, d3amza3, d3amza4, d3amza6, d3amzb1, d3amzb2, d3amzb3, d3amzb4, d3amzb6
    automated match to d1v97a3
    complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc

Details for d3amzb5

PDB Entry: 3amz (more details), 2.1 Å

PDB Description: Bovine Xanthine Oxidoreductase urate bound form
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3amzb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amzb5 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d3amzb5:

Click to download the PDB-style file with coordinates for d3amzb5.
(The format of our PDB-style files is described here.)

Timeline for d3amzb5: