| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries) Uniprot P01887 |
| Domain d1fg2k_: 1fg2 K: [20828] Other proteins in same PDB: d1fg2a1, d1fg2a2, d1fg2d1, d1fg2d2, d1fg2g1, d1fg2g2, d1fg2j1, d1fg2j2 |
PDB Entry: 1fg2 (more details), 2.75 Å
SCOPe Domain Sequences for d1fg2k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg2k_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1fg2k_: