![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
![]() | Protein Xanthine oxidase, domain 2 [47746] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3amzb2: 3amz B:93-165 [208279] Other proteins in same PDB: d3amza1, d3amza3, d3amza4, d3amza5, d3amza6, d3amzb1, d3amzb3, d3amzb4, d3amzb5, d3amzb6 automated match to d1v97a1 complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc |
PDB Entry: 3amz (more details), 2.1 Å
SCOPe Domain Sequences for d3amzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3amzb2 a.56.1.1 (B:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfak
Timeline for d3amzb2: