Lineage for d3amza4 (3amz A:415-529)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528291Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2528454Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2528455Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2528493Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 2528494Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
    Uniprot P80457
  8. 2528499Domain d3amza4: 3amz A:415-529 [208275]
    Other proteins in same PDB: d3amza1, d3amza2, d3amza3, d3amza5, d3amza6, d3amzb1, d3amzb2, d3amzb3, d3amzb5, d3amzb6
    automated match to d1fo4a4
    complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc

Details for d3amza4

PDB Entry: 3amz (more details), 2.1 Å

PDB Description: Bovine Xanthine Oxidoreductase urate bound form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3amza4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amza4 d.87.2.1 (A:415-529) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgk

SCOPe Domain Coordinates for d3amza4:

Click to download the PDB-style file with coordinates for d3amza4.
(The format of our PDB-style files is described here.)

Timeline for d3amza4: