![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries) Uniprot P80457 |
![]() | Domain d3amza1: 3amz A:3-92 [208272] Other proteins in same PDB: d3amza2, d3amza3, d3amza4, d3amza5, d3amza6, d3amzb2, d3amzb3, d3amzb4, d3amzb5, d3amzb6 automated match to d1fo4a2 complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc |
PDB Entry: 3amz (more details), 2.1 Å
SCOPe Domain Sequences for d3amza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3amza1 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq dkiihfsanaclapictlhhvavttvegig
Timeline for d3amza1: