Lineage for d3amza1 (3amz A:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934134Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 2934135Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 2934140Domain d3amza1: 3amz A:3-92 [208272]
    Other proteins in same PDB: d3amza2, d3amza3, d3amza4, d3amza5, d3amza6, d3amzb2, d3amzb3, d3amzb4, d3amzb5, d3amzb6
    automated match to d1fo4a2
    complexed with bct, ca, fad, fes, gol, mos, mte, nai, urc

Details for d3amza1

PDB Entry: 3amz (more details), 2.1 Å

PDB Description: Bovine Xanthine Oxidoreductase urate bound form
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3amza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amza1 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3amza1:

Click to download the PDB-style file with coordinates for d3amza1.
(The format of our PDB-style files is described here.)

Timeline for d3amza1: