Lineage for d3amob1 (3amo B:9-96)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640512Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1640513Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1640628Domain d3amob1: 3amo B:9-96 [208269]
    Other proteins in same PDB: d3amoa3, d3amob3
    automated match to d1ivwa2
    complexed with cu, gol, na

Details for d3amob1

PDB Entry: 3amo (more details), 2.1 Å

PDB Description: time-resolved x-ray crystal structure analysis of enzymatic reaction of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d3amob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amob1 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOPe Domain Coordinates for d3amob1:

Click to download the PDB-style file with coordinates for d3amob1.
(The format of our PDB-style files is described here.)

Timeline for d3amob1: