| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
| Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries) Uniprot P46881 9-628 |
| Domain d3amob1: 3amo B:9-96 [208269] Other proteins in same PDB: d3amoa3, d3amob3 automated match to d1ivwa2 complexed with cu, gol, na |
PDB Entry: 3amo (more details), 2.1 Å
SCOPe Domain Sequences for d3amob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3amob1 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg
Timeline for d3amob1: