Lineage for d3amoa3 (3amo A:212-627)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781478Species Arthrobacter globiformis [TaxId:1665] [50003] (41 PDB entries)
    Uniprot P46881 9-628
  8. 2781536Domain d3amoa3: 3amo A:212-627 [208268]
    Other proteins in same PDB: d3amoa1, d3amoa2, d3amob1, d3amob2
    automated match to d1ivwa1
    complexed with cu, gol, na

Details for d3amoa3

PDB Entry: 3amo (more details), 2.1 Å

PDB Description: time-resolved x-ray crystal structure analysis of enzymatic reaction of copper amine oxidase from arthrobacter globiformis
PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d3amoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3amoa3 b.30.2.1 (A:212-627) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpa

SCOPe Domain Coordinates for d3amoa3:

Click to download the PDB-style file with coordinates for d3amoa3.
(The format of our PDB-style files is described here.)

Timeline for d3amoa3: