Lineage for d3amgb_ (3amg B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084263Species Thermotoga maritima [TaxId:243274] [226181] (7 PDB entries)
  8. 2084281Domain d3amgb_: 3amg B: [208265]
    automated match to d1ceoa_
    complexed with bgc, cbi; mutant

Details for d3amgb_

PDB Entry: 3amg (more details), 2.4 Å

PDB Description: Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form
PDB Compounds: (B:) endoglucanase

SCOPe Domain Sequences for d3amgb_:

Sequence, based on SEQRES records: (download)

>d3amgb_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
gvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthay
afppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadr
ykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalek
lsvpkweknsivtihyynpfefthqgaewvegsekwlgrkwgspddqkhlieefnfieew
skknkrpiyigefgayrkadlesrikwtsfvvremekrrwswaywefcsgfgvydtlrkt
wnkdllealig

Sequence, based on observed residues (ATOM records): (download)

>d3amgb_ c.1.8.0 (B:) automated matches {Thermotoga maritima [TaxId: 243274]}
gvdpfernkilgrginignaleapnegdwgvvikdeffdiikeagfshvripirwsthay
afppykimdrffkrvdevingalkrglavvinihhyeelmndpeehkerflalwkqiadr
ykdypetlffeilnaphgnltpekwnelleealkvirsidkkhtiiigtaewggisalek
lsvpkweknsivtihyynpfefthqgaewvegsekfieewskknkrpiyigefgayrkad
lesrikwtsfvvremekrrwswaywefcsgfgvydtlrktwnkdllealig

SCOPe Domain Coordinates for d3amgb_:

Click to download the PDB-style file with coordinates for d3amgb_.
(The format of our PDB-style files is described here.)

Timeline for d3amgb_: